Structure of PDB 7nqh Chain BU

Receptor sequence

>7nqhBU (length=140) Species: 9823 (Sus scrofa) [Search protein sequence]

LRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRL
KKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYE
PKTFKSLAALAKRRREEGFAAALGDGKEPDGIFSRVVQHR

3D structure

PDB

7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BU	L10 R11 R13 T15 D16 R17 R20 H30 F31 R32 R34 K35 R37 C38 Y39 R40 L41 V43 R44 R48 A49 K52 C53 R55 A56 R57 R58 K60 K61 L64 R65 W68 I69 K82 Y83 P84 I88 N98 R99 R124 F128	L1 R2 R4 T6 D7 R8 R11 H21 F22 R23 R25 K26 R28 C29 Y30 R31 L32 V34 R35 R39 A40 K43 C44 R46 A47 R48 R49 K51 K52 L55 R56 W59 I60 K73 Y74 P75 I79 N89 R90 R115 F119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links