Structure of PDB 4v8f Chain BU

Receptor sequence

>4v8fBU (length=72) Species: 300852 (Thermus thermophilus HB8)

SRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRIL
AKTIKRARILGLLPFTEKLVRK

3D structure

• PDB: 4v8f A new understanding of the decoding principle on the ribosome.
• Chain: BU
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BU	K49 I50 R53 A60 K61 Q63 R64 K68 K71 R72 R74 I75 F81 T82	K33 I34 R37 A44 K45 Q47 R48 K52 K55 R56 R58 I59 F65 T66

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8f, PDBe:4v8f, PDBj:4v8f
• PDBsum: 4v8f
• PubMed: 22437501
• UniProt: Q5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)