Structure of PDB 4v6u Chain BU

Receptor sequence

>4v6uBU (length=121) Species: 186497 (Pyrococcus furiosus DSM 3638)

MKISSKQPRKQRKFLYNAPLHVRQKLMSAPLSRELREKYKVRNLPVRVGD
KVRIMRGDYKGHEGKVVEVDLKRYRIYVEGATLRKTNGTEVFYPIHPSNV
MIIELNLEDEKRKKIIERRAG

3D structure

• PDB: 4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
• Chain: BU
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BU	M1 K2 S4 S5 K6 Q7 P8 R9 K10 Q11 R12 Y16 L20 H21 Q24 K25 S28 P30 R33 R36 R42 N43 R47 R56 G57 D58 D70 L71 R73 R75 L83 K85 T86 N87 Y93 P94 H96 S98 N99 D109 K111 R112 I115 R119	M1 K2 S4 S5 K6 Q7 P8 R9 K10 Q11 R12 Y16 L20 H21 Q24 K25 S28 P30 R33 R36 R42 N43 R47 R56 G57 D58 D70 L71 R73 R75 L83 K85 T86 N87 Y93 P94 H96 S98 N99 D109 K111 R112 I115 R119

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
• PDBsum: 4v6u
• PubMed: 23222135
• UniProt: Q8U010|RL24_PYRFU Large ribosomal subunit protein uL24 (Gene Name=rpl24)