Structure of PDB 4v4r Chain BU

Receptor sequence

>4v4rBU (length=117) Species: 274 (Thermus thermophilus) [Search protein sequence]

PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRR
NKKRDFRRLWIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAR
EPEAFKALVDASRNARQ

3D structure

PDB

4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.

Chain

Resolution

5.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BU	P2 R3 A4 K5 T6 I8 R10 R11 R12 R13 H14 K15 K16 K22 G23 F24 W25 G26 S27 R28 K30 Y32 R33 N34 Q37 T38 N41 A42 Y45 E46 R48 D49 R50 R51 K53 K54 R55 F57 R59 W61 N75 Y76 S77 I80 N81 K84 R92 K93	P1 R2 A3 K4 T5 I7 R9 R10 R11 R12 H13 K14 K15 K21 G22 F23 W24 G25 S26 R27 K29 Y31 R32 N33 Q36 T37 N40 A41 Y44 E45 R47 D48 R49 R50 K52 K53 R54 F56 R58 W60 N74 Y75 S76 I79 N80 K83 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum	4v4r
PubMed	16377566
UniProt	Q9RSW7\|RL20_DEIRA Large ribosomal subunit protein bL20 (Gene Name=rplT)