Structure of PDB 8ove Chain BT

Receptor sequence

>8oveBT (length=192) Species: 5702 (Trypanosoma brucei brucei)

SLKLQARLAADILRCGRGRVWLDPNEAVEIRNANSRKSVRKLIKDGLVMR
KPVKVHSRSRWRQMKLAKSMGRHEGTGRREGTREARMPSKDLWMRRLRIL
RRLLRKYREEKKIDRHIYRELYMKAKGNVFRNKRNLMEHIHKVKNEKKKA
RQLAEQLAAKRLKDEQNRRKARKQELKKREKERERARRDDAA

3D structure

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BT
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BT	A173 E177 L178 K180 R181	A171 E175 L176 K178 R179
BS02	rna	BT	R9 R19 L24 P26 R38 R42 T84 E86 K92 W95 M125 K126 G129 N130	R7 R17 L22 P24 R36 R40 T82 E84 K90 W93 M123 K124 G127 N128
BS03	rna	BT	G18 R19 R21 V55 K56 H58 R60 W63 R74 T78 G79 R80 R81 E82 G83 R85 R88 R104 K135	G16 R17 R19 V53 K54 H56 R58 W61 R72 T76 G77 R78 R79 E80 G81 R83 R86 R102 K133
BS04	rna	BT	S59 R60 W63 R64 K92 W95 M96 R100 R103 R110 R117 H118 Y120 R121 Y124 K128	S57 R58 W61 R62 K90 W93 M94 R98 R101 R108 R115 H116 Y118 R119 Y122 K126
BS05	rna	BT	H58 S59 S61 R62 R80	H56 S57 S59 R60 R78

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: Q57ZI7