Structure of PDB 4v7r Chain BT

Receptor sequence
>4v7rBT (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGM
PHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKCR
QEFLERVKANAAKRAEAKA
3D structure
PDB4v7r Crystal structure of the eukaryotic ribosome.
ChainBT
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BT K3 S4 H5 G6 Y7 R8 S9 R12 M14 R17 H22 G23 G46 K50 G59 K60 T61 T68 S70 V72 V80 G81 K87 R88 K100 K1 S2 H3 G4 Y5 R6 S7 R10 M12 R15 H20 G21 G44 K48 G57 K58 T59 T66 S68 V70 V78 G79 K85 R86 K98
BS02 rna BT H26 L27 S28 H24 L25 S26
BS03 OHX BT Y13 Q16 Y11 Q14
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7r, PDBe:4v7r, PDBj:4v7r
PDBsum4v7r
PubMed21109664
UniProtQ02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]