Structure of PDB 4v7i Chain BT

Receptor sequence

>4v7iBT (length=85) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

PDB

4v7i Regulation of the protein-conducting channel by a bound ribosome.

Chain

Resolution

9.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BT	N2 I3 K4 S5 K7 K8 R9 R17 N20 A21 S22 R24 S25 M26 R28 T29 F30 K32 K33 Q54 P55 D58 R59 A62 K63 K68 N69 K70 R73 H74 K75 A76 N77 T79 Q81	N1 I2 K3 S4 K6 K7 R8 R16 N19 A20 S21 R23 S24 M25 R27 T28 F29 K31 K32 Q53 P54 D57 R58 A61 K62 K67 N68 K69 R72 H73 K74 A75 N76 T78 Q80

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008073	ornithine decarboxylase inhibitor activity
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v7i, PDBe:4v7i, PDBj:4v7i
PDBsum	4v7i
PubMed	19913480
UniProt	P0A7U7\|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)