Structure of PDB 4v7h Chain BT

Receptor sequence
>4v7hBT (length=80) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence]
YKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLK
VNTLVRPNGTKKAYVRLTADYDALDIANRI
3D structure
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
ChainBT
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BT Y60 K61 M88 K89 N91 Y93 Q94 K97 K120 Y1 K2 M29 K30 N32 Y34 Q35 K38 K61
BS02 rna BT T71 K74 K75 N80 N91 K92 Y93 K96 K109 N111 T112 L113 V114 R115 P116 K120 K121 Y123 R125 T12 K15 K16 N21 N32 K33 Y34 K37 K50 N52 T53 L54 V55 R56 P57 K61 K62 Y64 R66
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 22:57:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'BT', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='BT', title='Comprehensive molecular structure of the eukaryotic ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v7h', asym_id = 'BT'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v7h', asym_id='BT')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>