Structure of PDB 4v6u Chain BT

Receptor sequence
>4v6uBT (length=84) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
PYKVIIRPVVTEKAISLIEKENKLTFIVDRRATKQDIKRAVEEIFNVKVE
KVNTLITPRGEKKAYVKLKPEYSASEVAARLGLF
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainBT
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BT K5 K15 E23 R32 R33 T35 K36 Q37 K53 N55 T56 L57 I58 R61 K65 Y67 K3 K13 E21 R30 R31 T33 K34 Q35 K51 N53 T54 L55 I56 R59 K63 Y65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U000|RL23_PYRFU Large ribosomal subunit protein uL23 (Gene Name=rpl23)

[Back to BioLiP]