Structure of PDB 4v5d Chain BT

Receptor sequence
>4v5dBT (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAAKEEAQK
3D structure
PDB4v5d Insights into substrate stabilization from snapshots of the peptidyl transferase center of the intact 70S ribosome.
ChainBT
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BT K35 E36 R41 D107 R108 R118 D122 K35 E36 R41 D107 R108 R118 D122
BS02 rna BT N2 R3 G4 A5 R23 R51 R53 R54 N55 G56 N58 T60 I75 R93 R95 R96 A97 K98 F101 K113 K119 N2 R3 G4 A5 R23 R51 R53 R54 N55 G56 N58 T60 I75 R93 R95 R96 A97 K98 F101 K113 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5d, PDBe:4v5d, PDBj:4v5d
PDBsum4v5d
PubMed19363482
UniProtP60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]