Structure of PDB 4v5b Chain BT

Receptor sequence
>4v5bBT (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB4v5b A Peptide Deformylase-Ribosome Complex Reveals Mechanism of Nascent Chain Processing.
ChainBT
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BT N2 K4 A6 K8 R9 A16 R17 N20 S22 R24 S25 M26 R28 K32 Q54 P55 D58 R59 K63 K68 K70 A72 R73 K75 T79 Q81 N1 K3 A5 K7 R8 A15 R16 N19 S21 R23 S24 M25 R27 K31 Q53 P54 D57 R58 K62 K67 K69 A71 R72 K74 T78 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5b, PDBe:4v5b, PDBj:4v5b
PDBsum4v5b
PubMed18288106
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]