Structure of PDB 4v4r Chain BT

Receptor sequence
>4v4rBT (length=52) Species: 274 (Thermus thermophilus) [Search protein sequence]
RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLREARNLEWTDT
AR
3D structure
PDB4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBT
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BT E45 R47 R56 E41 R43 R52
BS02 rna BT S34 N38 N39 R44 W51 S31 N35 N36 R40 W47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum4v4r
PubMed16377566
UniProtP14116|RL24E_HALMA Large ribosomal subunit protein eL24 (Gene Name=rpl24e)

[Back to BioLiP]