Structure of PDB 3j9w Chain BT

Receptor sequence

>3j9wBT (length=117) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

PRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRR
QKKRDFRKLWITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVN
DLTAFNQLADAAKAQLN

3D structure

PDB

3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BT	P2 R3 V4 K5 T8 V9 T10 R11 K12 R13 R14 K15 K16 K19 K22 G23 Y24 F25 G26 S27 K28 H29 T30 L31 K33 V34 Q37 Q38 K41 S42 Y45 F47 R48 D49 R50 R51 Q52 K53 K54 R55 D56 F57 R58 K59 W61 N66 Y76 S77 H81 R92 K93 M94	P1 R2 V3 K4 T7 V8 T9 R10 K11 R12 R13 K14 K15 K18 K21 G22 Y23 F24 G25 S26 K27 H28 T29 L30 K32 V33 Q36 Q37 K40 S41 Y44 F46 R47 D48 R49 R50 Q51 K52 K53 R54 D55 F56 R57 K58 W60 N65 Y75 S76 H80 R91 K92 M93

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
PDBsum	3j9w
PubMed	25903689
UniProt	P55873\|RL20_BACSU Large ribosomal subunit protein bL20 (Gene Name=rplT)