Structure of PDB 1vy7 Chain BT

Receptor sequence

>1vy7BT (length=131) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAA

3D structure

PDB

1vy7 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BT	R39 R41 Y68 S106 D107 R108 R111 R118 K119 D122 R125	R39 R41 Y68 S106 D107 R108 R111 R118 K119 D122 R125
BS02	rna	BT	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R95 R96 A97 K98 Y100 F101 K113 K119	N2 R3 G4 R23 R51 R53 R54 N55 N58 T60 I75 R95 R96 A97 K98 Y100 F101 K113 K119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vy7, PDBe:1vy7, PDBj:1vy7
PDBsum	1vy7
PubMed	25132179
UniProt	P60490\|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)