Structure of PDB 4xej Chain BS10

Receptor sequence
>4xejBS10 (length=98) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainBS10
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS10 R5 H13 S35 G36 P37 I38 P39 P41 T42 R43 R45 R46 T48 R51 G52 P53 F54 K55 H56 K57 S59 R60 R66 H68 R70 R3 H11 S33 G34 P35 I36 P37 P39 T40 R41 R43 R44 T46 R49 G50 P51 F52 K53 H54 K55 S57 R58 R64 H66 R68
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtP62653|RS10_THET2 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]