Structure of PDB 8toc Chain BS |
>8tocBS (length=129) Species: 154784 (Acinetobacter phage AP205) [Search protein sequence] |
ANKPMQPITSTANKIVWSDPTRLSTTFSASLLRQRVKVGIAELNNVSGQY VSVYKRPAPKPEGCADACVIMPNENQSIRTVISGSAENLATLKAEWETHK RNVDTLFASGNAGLGFLDPTAAIVSSDTT |
|
PDB | 8toc Structural basis of Acinetobacter type IV pili targeting by an RNA virus |
Chain | BS |
Resolution | 3.11 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
BS |
T9 T11 N13 K14 |
T9 T11 N13 K14 |
|
|
|
|