Structure of PDB 8ova Chain BS

Receptor sequence

>8ovaBS (length=178) Species: 5702 (Trypanosoma brucei brucei)

VRPHLRHYCVVGRETPSEKNPQPTVYKFEVFAPNFVVAKSRFWRMMREKN
KVKSTHGDVLSCKVVKDRKLAARNYSVDIAYYSQRCGYTHMVKEFRDVCK
AGAVSQAYNDLASRHRARYHNIEVLGVKSIPNHEVRRLNVAQFHPHNLSF
PLLQRRVKAPRKDRVIFVKKNSKRAVVA

3D structure

• PDB: 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BS
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BS	V2 R3 C10 E30 V66 K67 R69 K70 R86 C87 M92 K94 N110 A113 S114 R115 R117 R119 P132 R138 Q155 K159 R162 R165 A179	V1 R2 C9 E29 V65 K66 R68 K69 R85 C86 M91 K93 N109 A112 S113 R114 R116 R118 P131 R137 Q154 K158 R161 R164 A178
BS02	rna	BS	L154 Q155 K170 N172 R175	L153 Q154 K169 N171 R174
BS03	rna	BS	S41 R45 K52 K54 Y83 Q85	S40 R44 K51 K53 Y82 Q84

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ova, PDBe:8ova, PDBj:8ova
• PDBsum: 8ova
• PubMed: 37985661
• UniProt: Q382C4