Structure of PDB 8evs Chain BS

Receptor sequence

>8evsBS (length=145) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKAD
VDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTL
ANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA

3D structure

PDB

8evs Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BS	Q136 H137 K139 T141 G142 R145	Q135 H136 K138 T140 G141 R144
BS02	C	BS	L131 T138 K139	L130 T137 K138
BS03	G	BS	Y30 R40	Y29 R39
BS04	A	BS	H127 R132 V133 R134	H126 R131 V132 R133
BS05	G	BS	N87 R123 R134	N86 R122 R133
BS06	A	BS	Q89 R123	Q88 R122
BS07	G	BS	Q89 N90	Q88 N89
BS08	U	BS	H122 R126 G135	H121 R125 G134
BS09	A	BS	R134 G135	R133 G134
BS10	C	BS	R41 F85	R40 F84
BS11	U	BS	G37 V38 G39 R41	G36 V37 G38 R40
BS12	U	BS	K36 V38	K35 V37
BS13	G	BS	H137 T138 K139	H136 T137 K138

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum	8evs
PubMed	37595043
UniProt	P0CX55\|RS18A_YEAST Small ribosomal subunit protein uS13A (Gene Name=RPS18A)