Structure of PDB 8c3a Chain BS

Receptor sequence

>8c3aBS (length=119) Species: 5476 (Candida albicans) [Search protein sequence]

LKVRTSTTFRLPKTLKLTRSPKYQRKSVPHYNRLDAHKIIVAPIATETAM
KKVEDGNTLVFQVDIKSNKHQIKSAVKELYDVDALYVNTLIRPNGTKKAY
IRLTSDYDALDIANRIGYI

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BS	L24 T30 T31 F32 R33 L34 P35 K36 T37 K39 L40 R42 S43 P44 K45 Y46 R48 T69 T71 N91 K92 H93 Y109 N111 T112 L113 I114 P116 K120 Y123 R125	L1 T7 T8 F9 R10 L11 P12 K13 T14 K16 L17 R19 S20 P21 K22 Y23 R25 T46 T48 N68 K69 H70 Y86 N88 T89 L90 I91 P93 K97 Y100 R102
BS02	rna	BS	R27 T37 L38 K49 H53 Y54 N55 R56 K61 K89 N91 H93 Q94	R4 T14 L15 K26 H30 Y31 N32 R33 K38 K66 N68 H70 Q71
BS03	MG	BS	R115 K121	R92 K98

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links