Structure of PDB 7lh5 Chain BS

Receptor sequence
>7lh5BS (length=102) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
YERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLAL
KLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAR
EG
3D structure
PDB7lh5 Structural basis for plazomicin antibiotic action and resistance.
ChainBS
Resolution3.27 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS Y7 E8 R13 R15 I18 R20 R89 Y92 Y94 Y1 E2 R7 R9 I12 R14 R83 Y86 Y88
BS02 rna BS R17 R25 F29 S31 L32 K33 Y36 Q38 G45 V46 T47 L54 G60 N61 K62 T63 K93 H95 R11 R19 F23 S25 L26 K27 Y30 Q32 G39 V40 T41 L48 G54 N55 K56 T57 K87 H89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
PDBsum7lh5
PubMed34117352
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]