Structure of PDB 4v9n Chain BS

Receptor sequence

>4v9nBS (length=98) Species: 262724 (Thermus thermophilus HB27)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

3D structure

• PDB: 4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
• Chain: BS
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BS	K11 F12 R13 N16 R17 I18 T21 F87 R89 Y94 R106	K1 F2 R3 N6 R7 I8 T11 F77 R79 Y84 R96
BS02	rna	BS	R15 K19 R25 F29 R30 S31 L32 H34 Y36 Q38 V46 T47 S50 A55 N61 K62 T63 H95 G96 R97	R5 K9 R15 F19 R20 S21 L22 H24 Y26 Q28 V36 T37 S40 A45 N51 K52 T53 H85 G86 R87
BS03	MG	BS	K62 R97	K52 R87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
• PDBsum: 4v9n
• PubMed: 23769667
• UniProt: Q72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)