Structure of PDB 4v9k Chain BS

Receptor sequence
>4v9kBS (length=99) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGG
3D structure
PDB4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainBS
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS F12 V14 R15 K19 F87 Y92 Y94 E107 G108 G109 F2 V4 R5 K9 F77 Y82 Y84 E97 G98 G99
BS02 rna BS R17 R25 S27 F29 S31 L32 H34 Y36 Q38 T47 A55 N61 K62 T63 P91 Y92 K93 H95 R7 R15 S17 F19 S21 L22 H24 Y26 Q28 T37 A45 N51 K52 T53 P81 Y82 K83 H85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
PDBsum4v9k
PubMed23812722
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]