Structure of PDB 4v8y Chain BS

Receptor sequence

>4v8yBS (length=172) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

4v8y Molecular architecture of a eukaryotic translational initiation complex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BS	A2 N65 H68 K71 S83 R84 S85 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 R137 Y139 K141 L144 K146 P153 H154 R155 Q157 K158 K161 Y165 P168 S169 T170 F171	A2 N65 H68 K71 S83 R84 S85 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 R137 Y139 K141 L144 K146 P153 H154 R155 Q157 K158 K161 Y165 P168 S169 T170 F171
BS02	rna	BS	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 K53 A54 R84 R117 R119	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 K53 A54 R84 R117 R119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum	4v8y
PubMed	24200810
UniProt	P0CX24\|RL20B_YEAST Large ribosomal subunit protein eL20B (Gene Name=RPL20B)

[Back to BioLiP]