Structure of PDB 4v7x Chain BS

Receptor sequence

>4v7xBS (length=98) Species: 300852 (Thermus thermophilus HB8)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

3D structure

• PDB: 4v7x Revisiting the structures of several antibiotics bound to the bacterial ribosome.
• Chain: BS
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BS	R13 R15 I18 K19 R20 F87 Y92 K93 Y94 E107 G108	R3 R5 I8 K9 R10 F77 Y82 K83 Y84 E97 G98
BS02	rna	BS	R17 R25 F29 S31 L32 K33 Y36 Q38 V46 T47 S50 A55 G60 N61 K62 T63 Y92 K93 H95 G96 R97	R7 R15 F19 S21 L22 K23 Y26 Q28 V36 T37 S40 A45 G50 N51 K52 T53 Y82 K83 H85 G86 R87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7x, PDBe:4v7x, PDBj:4v7x
• PDBsum: 4v7x
• PubMed: 20876130
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)