Structure of PDB 4v7i Chain BS

Receptor sequence
>4v7iBS (length=79) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB4v7i Regulation of the protein-conducting channel by a bound ribosome.
ChainBS
Resolution9.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS R2 S3 L4 K5 K6 F9 D11 H13 K16 K17 K28 R31 W33 S34 R35 R36 H51 N52 G53 R54 G71 E72 T76 R77 T78 Y79 R80 R1 S2 L3 K4 K5 F8 D10 H12 K15 K16 K27 R30 W32 S33 R34 R35 H50 N51 G52 R53 G70 E71 T75 R76 T77 Y78 R79
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7i, PDBe:4v7i, PDBj:4v7i
PDBsum4v7i
PubMed19913480
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]