Structure of PDB 4v6n Chain BS

Receptor sequence

>4v6nBS (length=82) Species: 562 (Escherichia coli) [Search protein sequence]

MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA

3D structure

PDB

4v6n Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

12.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BS	M1 V2 T3 R5 L6 R8 H9 G10 K12 K13 R14 F16 Q18 D23 S24 R25 N26 A27 R28 G30 R31 F32 I33 R35 F38 P41 I42 K46 R51 W60 Q63 G64 A65 T66 S68 R70 A73 K76 N79	M1 V2 T3 R5 L6 R8 H9 G10 K12 K13 R14 F16 Q18 D23 S24 R25 N26 A27 R28 G30 R31 F32 I33 R35 F38 P41 I42 K46 R51 W60 Q63 G64 A65 T66 S68 R70 A73 K76 N79

Gene Ontology

	Molecular Function
GO:0000400	four-way junction DNA binding
GO:0003735	structural constituent of ribosome
GO:0004519	endonuclease activity
GO:0004520	DNA endonuclease activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006259	DNA metabolic process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6n, PDBe:4v6n, PDBj:4v6n
PDBsum	4v6n
PubMed	22467828
UniProt	P0A7T3\|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)