Structure of PDB 4v6k Chain BS

Receptor sequence
>4v6kBS (length=88) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLRR
3D structure
PDB4v6k Structural insights into cognate versus near-cognate discrimination during decoding.
ChainBS
Resolution8.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS Q39 R52 V59 R87 R88 Q39 R52 V59 R87 R88
BS02 rna BS S1 T7 R16 D17 N19 D20 T21 G22 S23 Q27 L38 H41 H45 K47 D48 H50 S51 R53 L56 R57 S60 R63 K64 Y68 R71 S1 T7 R16 D17 N19 D20 T21 G22 S23 Q27 L38 H41 H45 K47 D48 H50 S51 R53 L56 R57 S60 R63 K64 Y68 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
PDBsum4v6k
PubMed21378755
UniProtQ8X9M2|RS15_ECO57 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]