Structure of PDB 4v6a Chain BS

Receptor sequence
>4v6aBS (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKL
KGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
3D structure
PDB4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
ChainBS
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS R9 R13 R15 I18 F87 Y92 Y94 G108 R1 R5 R7 I10 F79 Y84 Y86 G100
BS02 rna BS R17 R25 F29 S31 L32 K33 Y36 Q38 V46 T47 S50 A55 N61 K62 T63 K93 H95 R97 R9 R17 F21 S23 L24 K25 Y28 Q30 V38 T39 S42 A47 N53 K54 T55 K85 H87 R89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
PDBsum4v6a
PubMed19696344
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]