Structure of PDB 4v68 Chain BS

Receptor sequence
>4v68BS (length=98) Species: 274 (Thermus thermophilus) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
3D structure
PDB4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
ChainBS
Resolution6.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS R13 R15 K19 R20 A86 F87 Y92 Y94 R106 E107 G108 R3 R5 K9 R10 A76 F77 Y82 Y84 R96 E97 G98
BS02 rna BS R17 R25 F29 S31 L32 Y36 Q38 G45 V46 T47 A55 T63 R89 K93 H95 R7 R15 F19 S21 L22 Y26 Q28 G35 V36 T37 A45 T53 R79 K83 H85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v68, PDBe:4v68, PDBj:4v68
PDBsum4v68
PubMed19229291
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]