Structure of PDB 4v67 Chain BS

Receptor sequence
>4v67BS (length=98) Species: 274 (Thermus thermophilus) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
3D structure
PDB4v67 Crystal structure of a translation termination complex formed with release factor RF2.
ChainBS
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BS F12 R13 N16 R17 I18 T21 F87 R89 Y94 F2 R3 N6 R7 I8 T11 F77 R79 Y84
BS02 rna BS R15 K19 R25 F29 R30 S31 L32 H34 Q38 G45 V46 T47 S50 A55 N61 K62 T63 Y92 H95 G96 R97 R5 K9 R15 F19 R20 S21 L22 H24 Q28 G35 V36 T37 S40 A45 N51 K52 T53 Y82 H85 G86 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v67, PDBe:4v67, PDBj:4v67
PDBsum4v67
PubMed19064930
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]