Structure of PDB 4v5d Chain BS

Receptor sequence
>4v5dBS (length=98) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
3D structure
PDB4v5d Insights into substrate stabilization from snapshots of the peptidyl transferase center of the intact 70S ribosome.
ChainBS
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BS R13 R15 I18 K19 F87 Y92 Y94 E107 G108 R3 R5 I8 K9 F77 Y82 Y84 E97 G98
BS02 rna BS R17 R25 F29 S31 L32 K33 Y36 Q38 I40 G45 V46 T47 N61 K62 T63 K93 H95 R97 R7 R15 F19 S21 L22 K23 Y26 Q28 I30 G35 V36 T37 N51 K52 T53 K83 H85 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v5d, PDBe:4v5d, PDBj:4v5d
PDBsum4v5d
PubMed19363482
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]