Structure of PDB 4v4r Chain BS

Receptor sequence

>4v4rBS (length=113) Species: 274 (Thermus thermophilus) [Search protein sequence]

PMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTPNGDDTLAS
AHSSDLAEYGWEPTGSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPKVF
AIQEGAIDAGLDI

3D structure

PDB

4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.

Chain

Resolution

5.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BS	M10 R11 R23 R37 S39 K41 H42 R44 Q46 D56 A59 H62 S64 D65 E72 P74 T75 N107 S108 T110 P111	M2 R3 R15 R29 S31 K33 H34 R36 Q38 D46 A49 H52 S54 D55 E62 P63 T64 N93 S94 T96 P97
BS02	rna	BS	P9 R12 R13 R14 E15 A16 Y20 H21 R25 L26 K28 S29 G30 V101 L102 P109 Q119 I129	P1 R4 R5 R6 E7 A8 Y12 H13 R17 L18 K20 S21 G22 V87 L88 P95 Q103 I113

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum	4v4r
PubMed	16377566
UniProt	P14123\|RL18_HALMA Large ribosomal subunit protein uL18 (Gene Name=rpl18)