Structure of PDB 8evr Chain BR

Receptor sequence
>8evrBR (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIA
GYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRLNVDNQ
TSDLVKSLGLKLPLSVINVSA
3D structure
PDB8evr Regulation of translation by ribosomal RNA pseudouridylation.
ChainBR
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 G BR T6 K7 K10 T5 K6 K9
BS02 G BR K32 K44 K31 K43
BS03 C BR F28 N48 F27 N47
BS04 U BR R3 K49 R2 K48
BS05 G BR V4 R5 V3 R4
BS06 U BR R3 R45 R2 R44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8evr, PDBe:8evr, PDBj:8evr
PDBsum8evr
PubMed37595043
UniProtP02407|RS17A_YEAST Small ribosomal subunit protein eS17A (Gene Name=RPS17A)

[Back to BioLiP]