Structure of PDB 8b6f Chain BR |
>8b6fBR (length=91) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] |
LNPYSYEALKENHWLVSDSSKKNSEWTHKSNAEQLIAKVPIIYVDSNIVR CIGGTEINAGHPQVYIQLDTRKHGTPQTCKYCGLRYAKKMD |
|
PDB | 8b6f Structural basis of mitochondrial membrane bending by the I-II-III 2 -IV 2 supercomplex. |
Chain | BR |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
BR |
C87 H97 C115 |
C51 H61 C79 |
|
|
|
|