Structure of PDB 7zuw Chain BR

Receptor sequence

>7zuwBR (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

7zuw Structural basis for clearing of ribosome collisions by the RQT complex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BR	S39 Y43 K50 K52 K53 R84 R119	S38 Y42 K49 K51 K52 R83 R118
BS02	rna	BR	A2 N62 N65 H68 P69 R84 S85 H88 M90 Y91 Q108 A111 A112 R113 R115 R117 R137 Y139 L144 T145 K146 H154 S159 K161 Y165 K166 P168 S169 T170 F171	A1 N61 N64 H67 P68 R83 S84 H87 M89 Y90 Q107 A110 A111 R112 R114 R116 R136 Y138 L143 T144 K145 H153 S158 K160 Y164 K165 P167 S168 T169 F170

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zuw, PDBe:7zuw, PDBj:7zuw
PDBsum	7zuw
PubMed	36801861
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]