Structure of PDB 5j8a Chain BR

Receptor sequence
>5j8aBR (length=55) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLP
YTDRH
3D structure
PDB5j8a Resistance mutations generate divergent antibiotic susceptibility profiles against translation inhibitors.
ChainBR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BR K38 I39 P41 S42 R48 A49 K50 Q52 R53 K60 R61 R63 Y64 Y70 H74 K19 I20 P22 S23 R29 A30 K31 Q33 R34 K41 R42 R44 Y45 Y51 H55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j8a, PDBe:5j8a, PDBj:5j8a
PDBsum5j8a
PubMed27382179
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]