Structure of PDB 4v97 Chain BR

Receptor sequence

>4v97BR (length=117) Species: 300852 (Thermus thermophilus HB8)

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

• PDB: 4v97 Reorganization of an intersubunit bridge induced by disparate 16S ribosomal ambiguity mutations mimics an EF-Tu-bound state.
• Chain: BR
• Resolution: 3.516 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BR	R2 H3 L4 K5 S6 G7 L10 R12 H13 H16 R17 L20 N23 Q24 K26 H31 I34 T35 T36 T37 P39 K40 K42 R45 G46 D49 H50 H53 L60 H61 R63 R64 L67 R68 Q71 V73 R77 R90 Q91 G92 G93 R96 K99 R104 R105 G106 D107 V117	R1 H2 L3 K4 S5 G6 L9 R11 H12 H15 R16 L19 N22 Q23 K25 H30 I33 T34 T35 T36 P38 K39 K41 R44 G45 D48 H49 H52 L59 H60 R62 R63 L66 R67 Q70 V72 R76 R89 Q90 G91 G92 R95 K98 R103 R104 G105 D106 V116

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v97, PDBe:4v97, PDBj:4v97
• PDBsum: 4v97
• PubMed: 23630274
• UniProt: Q9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)