Structure of PDB 4v8z Chain BR

Receptor sequence

>4v8zBR (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 4v8z Molecular architecture of a eukaryotic translational initiation complex.
• Chain: BR
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BR	A159 A161 R162 R163 L164 K165 N166 R167 A168 A169 R170 D171 R172 R173 A174 Q175 R176 V177	A158 A160 R161 R162 L163 K164 N165 R166 A167 A168 R169 D170 R171 R172 A173 Q174 R175 V176
BS02	rna	BR	N3 R5 K8 R9 G18 K19 R20 L24 R38 N39 R42 K43 K46 H58 S59 K60 S61 R62 R64 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 R85 R88 L89 P90 Q92 V93 I96 R97 R100 V101 R103 R104 Y109 K114 H118 Y120 H121 Y124 K125 K128 H134 K135 R136 I143	N2 R4 K7 R8 G17 K18 R19 L23 R37 N38 R41 K42 K45 H57 S58 K59 S60 R61 R63 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 R84 R87 L88 P89 Q91 V92 I95 R96 R99 V100 R102 R103 Y108 K113 H117 Y119 H120 Y123 K124 K127 H133 K134 R135 I142
BS03	OHX	BR	N166 R170	N165 R169

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
• PDBsum: 4v8z
• PubMed: 24200810
• UniProt: P0CX83|RL19B_YEAST Large ribosomal subunit protein eL19 (Gene Name=RPL19B)