Structure of PDB 4v8x Chain BR

Receptor sequence

>4v8xBR (length=117) Species: 300852 (Thermus thermophilus HB8)

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

• PDB: 4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
• Chain: BR
• Resolution: 3.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BR	R2 H3 L4 K5 S6 G7 R8 L10 N11 R12 H13 S14 S15 H16 R17 L20 R22 N23 Q24 K26 H31 I34 T35 T36 T37 K40 K42 D49 H53 L60 H61 R63 R64 R68 Q71 R77 R90 G92 G93 T95 R96 K99 R104 R105 G106 D107 V117	R1 H2 L3 K4 S5 G6 R7 L9 N10 R11 H12 S13 S14 H15 R16 L19 R21 N22 Q23 K25 H30 I33 T34 T35 T36 K39 K41 D48 H52 L59 H60 R62 R63 R67 Q70 R76 R89 G91 G92 T94 R95 K98 R103 R104 G105 D106 V116

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
• PDBsum: 4v8x
• PubMed: 23945936
• UniProt: Q9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)