Structure of PDB 4v63 Chain BR

Receptor sequence

>4v63BR (length=117) Species: 262724 (Thermus thermophilus HB27)

RHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHL
IHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLA
ERRRGDGAPLALVELVE

3D structure

• PDB: 4v63 Structural basis for translation termination on the 70S ribosome
• Chain: BR
• Resolution: 3.207 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BR	R2 H3 L4 K5 S6 K9 L10 N11 H13 S14 S15 H16 N23 Q24 S27 H31 I34 T35 T36 T37 K40 K42 R45 H50 H53 R57 L60 H61 R63 R64 R68 R77 G92 G93 R96 R104 R105 G106 D107	R1 H2 L3 K4 S5 K8 L9 N10 H12 S13 S14 H15 N22 Q23 S26 H30 I33 T34 T35 T36 K39 K41 R44 H49 H52 R56 L59 H60 R62 R63 R67 R76 G91 G92 R95 R103 R104 G105 D106

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v63, PDBe:4v63, PDBj:4v63
• PDBsum: 4v63
• PubMed: 18596689
• UniProt: Q72I33|RL17_THET2 Large ribosomal subunit protein bL17 (Gene Name=rplQ)