Structure of PDB 4v4z Chain BR

Receptor sequence

>4v4zBR (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

3D structure

PDB

4v4z Structural basis for messenger RNA movement on the ribosome.

Chain

Resolution

4.51 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BR	R3 L4 T5 A6 E8 R9 F12 R15 R20 G22 F87 Y94	R1 L2 T3 A4 E6 R7 F10 R13 R18 G20 F85 Y92
BS02	rna	BR	R25 S27 F29 S31 L32 K33 H34 Y36 Q38 E43 G45 T47 S50 K59 G60 N61 K62 T63 Y92 K93 H95 G96 R97	R23 S25 F27 S29 L30 K31 H32 Y34 Q36 E41 G43 T45 S48 K57 G58 N59 K60 T61 Y90 K91 H93 G94 R95

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
PDBsum	4v4z
PubMed	17051149
UniProt	Q5SHQ4\|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)