Structure of PDB 4v4y Chain BR

Receptor sequence
>4v4yBR (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainBR
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BR L4 T5 E8 R9 R15 R20 G22 F87 Y94 L2 T3 E6 R7 R13 R18 G20 F85 Y92
BS02 rna BR R25 S27 F29 R30 L32 K33 H34 Y36 Q38 E43 G45 T47 S50 S53 K59 G60 N61 T63 Y92 K93 H95 G96 R97 R23 S25 F27 R28 L30 K31 H32 Y34 Q36 E41 G43 T45 S48 S51 K57 G58 N59 T61 Y90 K91 H93 G94 R95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]