Structure of PDB 4v4p Chain BR

Receptor sequence
>4v4pBR (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
ChainBR
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BR L57 R88 L56 R87
BS02 rna BR P2 K8 Q9 I12 F18 G20 D21 T22 G23 S24 Q28 H46 K48 D49 H50 H51 R54 M58 G61 R64 R65 R68 Y69 R72 P1 K7 Q8 I11 F17 G19 D20 T21 G22 S23 Q27 H45 K47 D48 H49 H50 R53 M57 G60 R63 R64 R67 Y68 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4p, PDBe:4v4p, PDBj:4v4p
PDBsum4v4p
PubMed15802605
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]