Structure of PDB 8evs Chain BQ

Receptor sequence

>8evsBQ (length=141) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR

3D structure

PDB

8evs Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BQ	Q139 K140 Y142	Q137 K138 Y140
BS02	U	BQ	Q8 T9	Q6 T7
BS03	A	BQ	P126 K128	P124 K126
BS04	C	BQ	G71 G72 H74 Q77	G69 G70 H72 Q75
BS05	A	BQ	G71 G72	G69 G70
BS06	G	BQ	K14 R122 R123	K12 R120 R121
BS07	U	BQ	P124 E125 R135	P122 E123 R133
BS08	A	BQ	G133 A134 R135 S136	G131 A132 R133 S134
BS09	U	BQ	K127 F129 G130	K125 F127 G128
BS10	C	BQ	P126 K127	P124 K125
BS11	U	BQ	K14 S15 G72 G73	K12 S13 G70 G71
BS12	U	BQ	V75 S76	V73 S74
BS13	U	BQ	Q139 K140 Y142	Q137 K138 Y140
BS14	C	BQ	S136 R137 K140	S134 R135 K138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum	8evs
PubMed	37595043
UniProt	P0CX51\|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)