Structure of PDB 8cq7 Chain BQ

Receptor sequence
>8cq7BQ (length=131) Species: 5476 (Candida albicans) [Search protein sequence]
SGNKFRMSLALPVGAVMNCADNSGARNLYVLAVKGTGARLNRLPAAAAGD
MVMATVKKGKPELRKKVMPAIVIRQSKPWRRRDGVYLYFEDNAGVIVNPK
GEMKGSAITGPVAKECADLWPRIASNSGVVV
3D structure
PDB8cq7 Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
ChainBQ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BQ S7 N9 F11 R12 S14 A16 P18 A21 V22 Y35 L37 K40 G41 T42 A44 R45 L46 N47 R48 L49 M59 T61 K71 V73 K83 R86 Y92 N98 S1 N3 F5 R6 S8 A10 P12 A15 V16 Y29 L31 K34 G35 T36 A38 R39 L40 N41 R42 L43 M53 T55 K65 V67 K77 R80 Y86 N92
BS02 MG BQ T42 G43 T36 G37
External links