Structure of PDB 7nsj Chain BQ

Receptor sequence

>7nsjBQ (length=222) Species: 9823 (Sus scrofa) [Search protein sequence]

FKTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEA
TEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFK
PITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLV
AHKLPFPAKAVSRETLEKMRKDQEERERNNQNPWTFERIATANMLGIRKV
LSPYDLTHKGRYWGKFYTPERV

3D structure

PDB

7nsj Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	F30 K31 R63 R64 R66 K67 R73 Y96 G100 H101 M104 R111 K116 R133 M136 G137 R139 M140 G141 G142 G143 K144 L178 H181 K182 P184 R227 K228 V229 S231 P232 Y233 K244	F1 K2 R34 R35 R37 K38 R44 Y67 G71 H72 M75 R82 K87 R104 M107 G108 R110 M111 G112 G113 G114 K115 L149 H152 K153 P155 R198 K199 V200 S202 P203 Y204 K215
BS02	MG	BQ	H181 L183	H152 L154

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nsj, PDBe:7nsj, PDBj:7nsj
PDBsum	7nsj
PubMed	33878294
UniProt	F1RI89

[Back to BioLiP]