Structure of PDB 6th6 Chain BQ

Receptor sequence

>6th6BQ (length=164) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]

AHGPRYRVPFRRRREGKTNYHKRLKLLKSKKPRLVVRKTLNHHIAQIVVY
DPKGDKTLVSAHTMELMRGNTPSAYLLGLLIGYKAKQAGIEEAILDIGLH
PPTRGSSIFAVLKGAVDAGLNVPHSEEIYPEDYRINGEHIANYAKAKLPE
HFEEVKAKIIEKFE

3D structure

PDB

6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	R6 Y7 R8 R14 T19 K23 K26 L27 S30 L108 S134 I137	R5 Y6 R7 R13 T18 K22 K25 L26 S29 L99 S125 I128
BS02	rna	BQ	A2 G4 P5 F11 R12 R13 T19 Y21 R24 R38 T40 Q47 P53 G55 D56 T58 R69 P110 R113 R143 H148 Y152	A1 G3 P4 F10 R11 R12 T18 Y20 R23 R37 T39 Q46 P52 G54 D55 T57 R68 P101 R104 R134 H139 Y143

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6th6, PDBe:6th6, PDBj:6th6
PDBsum	6th6
PubMed	32555463
UniProt	Q5JJG7\|RL18_THEKO Large ribosomal subunit protein uL18 (Gene Name=rpl18)

[Back to BioLiP]