Structure of PDB 5aj4 Chain BQ

Receptor sequence

>5aj4BQ (length=221) Species: 9823 (Sus scrofa) [Search protein sequence]

KTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEAT
EFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFKP
ITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLVA
HKLPFPAKAVSRETLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVL
SPYDLTHKGRYWGKFYTPERV

3D structure

PDB

5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	F52 R106	F22 R76
BS02	rna	BQ	K31 R63 R64 R66 K67 L69 R73 H101 M104 R111 R133 M136 G137 Q138 R139 M140 G141 G142 G143 K144 H181 K182 P184 R227 K228 V229 S231 P232 Y233	K1 R33 R34 R36 K37 L39 R43 H71 M74 R81 R103 M106 G107 Q108 R109 M110 G111 G112 G113 K114 H151 K152 P154 R197 K198 V199 S201 P202 Y203

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5aj4, PDBe:5aj4, PDBj:5aj4
PDBsum	5aj4
PubMed	25837512
UniProt	F1RI89

[Back to BioLiP]