Structure of PDB 5aa0 Chain BQ

Receptor sequence

>5aa0BQ (length=114) Species: 300852 (Thermus thermophilus HB8)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRK

3D structure

• PDB: 5aa0 Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
• Chain: BQ
• Resolution: 5.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	N12 K13 R14 Y21 I22 Y23 G24 I25 A28 R29 R44 L66 L70 V74 Y87 H92 L96 P97 V98 R99 Q101 R102 T103 R104 T105 A107 R108 T109 R110 K111 R114 K115	N11 K12 R13 Y20 I21 Y22 G23 I24 A27 R28 R43 L65 L69 V73 Y86 H91 L95 P96 V97 R98 Q100 R101 T102 R103 T104 A106 R107 T108 R109 K110 R113 K114

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5aa0, PDBe:5aa0, PDBj:5aa0
• PDBsum: 5aa0
• PubMed: 26283392
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)