Structure of PDB 4v6u Chain BQ

Receptor sequence

>4v6uBQ (length=150) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]

MNTLKMQRRIAAEILKCGENRIWIDPERIDDVASAITREDIKRLIKEGVI
KKKPIKGQSRYRAKIRHEQKKKGRHRGPGSRKGKKTARMGKKELWIKTIR
ALRKELRKLKAQKKIDRKTYRMLYIRAKGGQFKNKHQLYLFLEEHGLLKK

3D structure

PDB

4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.

Chain

Resolution

6.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	M1 L4 K5 R8 K16 G18 E19 N20 R21 I22 W23 I24 R43 I55 K56 G57 Q58 S59 R60 Y61 K64 Q69 K71 R74 H75 R76 G79 R81 K82 G83 K84 K85 R88 M89 W95 I96 R100 A101 R103 R107 R121 Y124 K128 G129 Q131	M1 L4 K5 R8 K16 G18 E19 N20 R21 I22 W23 I24 R43 I55 K56 G57 Q58 S59 R60 Y61 K64 Q69 K71 R74 H75 R76 G79 R81 K82 G83 K84 K85 R88 M89 W95 I96 R100 A101 R103 R107 R121 Y124 K128 G129 Q131

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum	4v6u
PubMed	23222135
UniProt	Q8U016\|RL19E_PYRFU Large ribosomal subunit protein eL19 (Gene Name=rpl19e)

[Back to BioLiP]